Free shipping on orders over $200

Every batch ships with a third-party certificate of analysis

Orders placed before 1 PM Pacific usually ship the same business day

RWPLaboratories
0
Peptides15 in stock Peptide Blends4 in stock Nucleotides1 in stock Shop allEvery in-stock compound
Peptide blendsTwo to four peptides combined in one lyophilized vial.
COA Library Wholesale and bulk pricing
Research HubResearch peptides primerStorage and handling
GlossaryHow to read a COA
Quality standardsCOA LibraryFAQ
Sermorelin 10 mg research vial
MW 3357.9 g/molCAS 86168-78-7
Purity≥99%
FormLyophilized
Storage2 to 8 °C
Peptides

Sermorelin

Also known as Sermorelin acetate

Synthetic 29-residue peptide amide (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2), supplied as a lyophilized powder.

Request access to view pricingYour access request is under review

Pricing and ordering are available to approved research accounts only. Submit a research access request and pricing unlocks immediately.

Pricing and ordering unlock as soon as your research account is approved.

Request access

Already approved? Sign in

View request status

In stock, usually ships in 1 business day

Batch COAHPLC + MS on every batch
Tracked shippingUsually ships in 1 business day
Bulk pricingFrom 10 units

For research use only. All products are sold strictly for laboratory research and analytical use and are not for human consumption. They are not drugs, foods, cosmetics or supplements. We do not sell syringes or needles.

About this compound

Sermorelin is a synthetic linear peptide of 29 amino acids with a C-terminal amide. It is supplied as the acetate salt, a lyophilized powder in a sealed glass vial, for laboratory research and analytical use.

What you receive

One sealed vial of lyophilized compound, labeled with its lot number. The batch COA is in our COA Library.

Not sold or supplied

Syringes, needles or usage instructions. RWP Laboratories sells research materials only.

This page lists chemical identity, specifications, storage conditions and batch documentation only.

Specifications

Molecular weight3357.9g/mol
FormulaC149H246N44O42S
Length29 residuesSynthetic 29-residue peptide amide
CAS number86168-78-7
Amino acid sequence29 residues · N → C
NonpolarAromaticBasic (+)Acidic (−)Polar

C-terminal amide.

Class
Synthetic 29-residue peptide amide
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR
Length
29 residues
Molecular formula
C149H246N44O42S
Molecular weight
3357.9 g/mol
CAS number
86168-78-7
Purity
≥99% (HPLC)
Form
Lyophilized powder
Shelf life
24 months from date of manufacture
Counter-ion
Acetate
Storage
2 to 8 °C (36 to 46 °F), protected from light
Documentation
HPLC chromatogram, mass spectrum, lot COA

Reference values from public chemical databases. The certificate of analysis for your lot is the authority for that vial.

Storage and handling

Store cold

Sealed vials at 2 to 8 °C (36 to 46 °F), protected from light, as printed on the label. Freeze at −20 °C for long-term storage.

Warm before opening

Let cold vials reach room temperature to prevent condensation on the powder.

Keep sealed

Store in the original sealed vial, dry and away from light, until the material is needed.

More detail in our storage and handling guide.

Questions

Does Sermorelin ship with a certificate of analysis?

Yes. Every lot is tested for identity by mass spectrometry and purity by HPLC before release. The lot number on your vial matches its COA in our COA Library.

How should Sermorelin be stored?

Keep sealed vials refrigerated at 2 to 8 °C (36 to 46 °F) and protected from light, as printed on the label. For long-term storage, freeze at −20 °C. Let a cold vial reach room temperature before opening. See our storage guide.

Does Sermorelin come with syringes or needles?

No. RWP Laboratories does not sell or supply syringes or needles, and does not provide usage instructions.

Related compounds

More peptides