How to Read a Peptide Certificate of Analysis
HPLC purity, mass-spec identity, net peptide content and the red flags that should make you ask questions.
Read articlePopular
MW 4963.4 g/molCAS 77591-33-4
Purity≥99%
FormLyophilized
Storage2 to 8 °C
Synthetic 43-residue N-acetylated peptide (thymosin β4), supplied as a lyophilized powder.
Batch COAHPLC + MS on every batch
Tracked shippingUsually ships in 1 business day
Bulk pricingFrom 10 units
For research use only. All products are sold strictly for laboratory research and analytical use and are not for human consumption. They are not drugs, foods, cosmetics or supplements. We do not sell syringes or needles.
About this compound
TB-500 is the catalog name for synthetic thymosin β4, a linear peptide of 43 amino acids with an acetylated N-terminus. Some suppliers use the name for the much shorter LKKTETQ fragment, so the mass-spectrometry result on the batch COA confirms which material a vial contains. Supplied as a lyophilized powder in a sealed glass vial.
What you receive
One sealed vial of lyophilized compound, labeled with its lot number. The batch COA is in our COA Library.
Not sold or supplied
Syringes, needles or usage instructions. RWP Laboratories sells research materials only.
This page lists chemical identity, specifications, storage conditions and batch documentation only.
Specifications
Molecular weight4963.4g/mol
FormulaC212H350N56O78S
Length43 residuesSynthetic 43-residue peptide
CAS number77591-33-4
Amino acid sequence43 residues · N → C
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NonpolarAromaticBasic (+)Acidic (−)Polar
N-terminal acetylation.
- Class
- Synthetic 43-residue peptide
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Length
- 43 residues
- Molecular formula
- C212H350N56O78S
- Molecular weight
- 4963.4 g/mol
- CAS number
- 77591-33-4
- Purity
- ≥99% (HPLC)
- Form
- Lyophilized powder
- Shelf life
- 24 months from date of manufacture
- Counter-ion
- Stated on lot COA
- Storage
- 2 to 8 °C (36 to 46 °F), protected from light
- Documentation
- HPLC chromatogram, mass spectrum, lot COA
Reference values from public chemical databases. The certificate of analysis for your lot is the authority for that vial.
Storage and handling
Store cold
Sealed vials at 2 to 8 °C (36 to 46 °F), protected from light, as printed on the label. Freeze at −20 °C for long-term storage.
Warm before opening
Let cold vials reach room temperature to prevent condensation on the powder.
Keep sealed
Store in the original sealed vial, dry and away from light, until the material is needed.
More detail in our storage and handling guide.
Questions
Is TB-500 the full thymosin β4 sequence or a fragment?
The name is used for both. Full-length thymosin β4 has a mass near 4,963 Da; the LKKTETQ fragment is under 900 Da. The mass-spec section of the lot COA shows which one a vial contains. RWP Laboratories supplies the full 43-residue sequence.
Does TB-500 ship with a certificate of analysis?
Yes. Every lot is tested for identity by mass spectrometry and purity by HPLC before release. The lot number on your vial matches its COA in our COA Library.
How should TB-500 be stored?
Keep sealed vials refrigerated at 2 to 8 °C (36 to 46 °F) and protected from light, as printed on the label. For long-term storage, freeze at −20 °C. Let a cold vial reach room temperature before opening. See our storage guide.
Does TB-500 come with syringes or needles?
No. RWP Laboratories does not sell or supply syringes or needles, and does not provide usage instructions.
Related reading
Related compounds
Popular
Popular
Peptides
GHK-Cu
Copper(II) complex of the tripeptide Gly-His-Lys, supplied as a blue lyophilized powder.
Popular
Peptides
CJC-1295 with DAC
Synthetic 29-residue peptide with a C-terminal maleimidopropionyl lysine (DAC), supplied as a lyophilized powder.
Peptides
IGF-1 LR3
83-residue IGF-I analog with an Arg3 substitution and a 13-residue N-terminal extension, supplied as a lyophilized powder.
Peptides
Tesamorelin
Synthetic 44-residue peptide amide with an N-terminal trans-3-hexenoyl group, supplied as a lyophilized powder.