Free shipping on orders over $200

Every batch ships with a third-party certificate of analysis

Orders placed before 1 PM Pacific usually ship the same business day

RWPLaboratories
0
Peptides15 in stock Peptide Blends4 in stock Nucleotides1 in stock Shop allEvery in-stock compound
Peptide blendsTwo to four peptides combined in one lyophilized vial.
COA Library Wholesale and bulk pricing
Research HubResearch peptides primerStorage and handling
GlossaryHow to read a COA
Quality standardsCOA LibraryFAQ
IGF-1 LR3 1 mg research vial
MW 9117.5 g/molCAS 946870-92-4
Purity≥99%
FormLyophilized
Storage2 to 8 °C
Peptides

IGF-1 LR3

Also known as Long R3 IGF-I

83-residue IGF-I analog with an Arg3 substitution and a 13-residue N-terminal extension, supplied as a lyophilized powder.

Request access to view pricingYour access request is under review

Pricing and ordering are available to approved research accounts only. Submit a research access request and pricing unlocks immediately.

Pricing and ordering unlock as soon as your research account is approved.

Request access

Already approved? Sign in

View request status

In stock, usually ships in 1 business day

Batch COAHPLC + MS on every batch
Tracked shippingUsually ships in 1 business day
Bulk pricingFrom 10 units

For research use only. All products are sold strictly for laboratory research and analytical use and are not for human consumption. They are not drugs, foods, cosmetics or supplements. We do not sell syringes or needles.

About this compound

IGF-1 LR3 (Long R3 IGF-I) is an 83-amino-acid analog of IGF-I: the 70-residue IGF-I sequence with arginine in place of glutamic acid at position 3, preceded by a 13-residue N-terminal extension. It contains three disulfide bridges. Supplied as a lyophilized powder in a sealed glass vial for laboratory research and analytical use.

What you receive

One sealed vial of lyophilized compound, labeled with its lot number. The batch COA is in our COA Library.

Not sold or supplied

Syringes, needles or usage instructions. RWP Laboratories sells research materials only.

This page lists chemical identity, specifications, storage conditions and batch documentation only.

Specifications

Molecular weight9117.5g/mol
FormulaC400H625N111O115S9
Length83 residues83-residue IGF-I analog
CAS number946870-92-4
Amino acid sequence83 residues · N → C
NonpolarAromaticBasic (+)Acidic (−)Polar

Three disulfide bridges. Residues 1 to 13 are the N-terminal extension; Arg16 replaces the native Glu3.

Class
83-residue IGF-I analog
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Length
83 residues
Molecular formula
C400H625N111O115S9
Molecular weight
9117.5 g/mol
CAS number
946870-92-4
Purity
≥99% (HPLC)
Form
Lyophilized powder
Shelf life
24 months from date of manufacture
Counter-ion
Stated on lot COA
Storage
2 to 8 °C (36 to 46 °F), protected from light
Documentation
HPLC chromatogram, mass spectrum, lot COA

Reference values from public chemical databases. The certificate of analysis for your lot is the authority for that vial.

Storage and handling

Store cold

Sealed vials at 2 to 8 °C (36 to 46 °F), protected from light, as printed on the label. Freeze at −20 °C for long-term storage.

Warm before opening

Let cold vials reach room temperature to prevent condensation on the powder.

Keep sealed

Store in the original sealed vial, dry and away from light, until the material is needed.

More detail in our storage and handling guide.

Questions

How is the identity of IGF-1 LR3 confirmed?

By mass spectrometry. At about 9,117 Da the protein appears as a series of multiply charged ions, and the deconvoluted mass on the lot COA should match the theoretical value.

Does IGF-1 LR3 ship with a certificate of analysis?

Yes. Every lot is tested for identity by mass spectrometry and purity by HPLC before release. The lot number on your vial matches its COA in our COA Library.

How should IGF-1 LR3 be stored?

Keep sealed vials refrigerated at 2 to 8 °C (36 to 46 °F) and protected from light, as printed on the label. For long-term storage, freeze at −20 °C. Let a cold vial reach room temperature before opening. See our storage guide.

Does IGF-1 LR3 come with syringes or needles?

No. RWP Laboratories does not sell or supply syringes or needles, and does not provide usage instructions.

Related compounds

More peptides